PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.6011s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 248aa    MW: 27232.4 Da    PI: 7.4713
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.6011s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.44.2e-18167201135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  Cagra.6011s0001.1.p 167 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 201
                          *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169927.3E-882245IPR016679Transcription factor, GATA, plant
SuperFamilySSF577162.04E-14160223No hitNo description
SMARTSM004014.5E-16161211IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.451161197IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-13165199IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.29E-13166213No hitNo description
PROSITE patternPS003440167192IPR000679Zinc finger, GATA-type
PfamPF003206.7E-16167201IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MDVYGMSSPD LLRIDDLLDF SNDELFSSSS STVTSSAASS AASSSFPSEN PFNFPSSAYT  60
SPPLLTDFTH DLCVPSDDAA HLEWLSRFVD DSFSDYPTNP LTMTVRPEIS FTGKPRSRRS  120
RAPAPSVAGT WAPMPESELC HSVPKTKHKK EYNAEPVTPD VGGARRCTHC ASEKTPQWRT  180
GPLGPKTLCN ACGVRFKSGR LVPEYRPASS PTFVLTQHSN SHRKVMELRR QKEQQESCAS  240
IPTFQPR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291749.10.0hypothetical protein CARUB_v10017916mg
SwissprotO497431e-138GATA4_ARATH; GATA transcription factor 4
TrEMBLR0FQ220.0R0FQ22_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__2520__AT3G60530.11e-136(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32032666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-112GATA transcription factor 4